PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G086700.2.p
Common NameSb05g007050, SORBIDRAFT_05g007050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 395aa    MW: 40831.9 Da    PI: 7.9173
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G086700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.61.3e-3284140259
           ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                           ++v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+ev++
  Sobic.005G086700.2.p  84 SAVKYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKEVDD 140
                           5799*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.2E-2986138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-3087138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2487137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.73588137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.7E-30251322IPR009057Homeodomain-like
SuperFamilySSF466892.17E-20252320IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-26262318IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MDLSGTQGEL AIPMHANVAS PYGGGGGGGH VLQQLHGRGD HGSNNNGQQS PVSAAALTPS  60
PPVAAVEETE SSGKKRGPVA GASSAVKYRE CLKNHAAAIG GNATDGCGEF MPSGEEGSLE  120
ALKCSACGCH RNFHRKEVDD DDDDVYAAAD GFSGLGLGHG HRAARRLLAP AMAHPHHKTG  180
GGGGLLISGA DPYGAYAASR ALPPALPPPP GHGHAHHHQY VMPLNMMHTS ESDEMEGGGG  240
GAVAGCVDAA RGGGSGGSSS SRKRFRTKFT PEQKARMLEF AERVGWRLQR LDDGMVQAFC  300
QEIGVKRRVL KVWMHNNKHN LATKRLEASP AAAQEQQAMA PGMASPPPPP PPQHHMPLHM  360
PAAVMPPPPP PLPTQTGPSC HRGGPGSPLP LKLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-242623201775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9668550.0EU966855.1 Zea mays clone 297761 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449277.10.0hypothetical protein SORBIDRAFT_05g007050
SwissprotQ53N875e-93ZHD4_ORYSJ; Zinc-finger homeodomain protein 4
TrEMBLC5Y7T90.0C5Y7T9_SORBI; Putative uncharacterized protein Sb05g007050
STRINGSb05g007050.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.28e-57homeobox protein 31